Toggle menu
+44 20 3393 8531
  • LoginorSign Up
  • 0
PRS BioSciences | IHC Microscopy
×
×

    Shop By Category

  • Gentaur Antibodies
    • Gentaur Antibodies
    • Gentaur Goat Antibodies
    • Gentaur Human Antibodies
    • Gentaur Monoclonal Antibodies
    • Gentaur Mouse Antibodies
    • Gentaur Polyclonal Antibodies
    • Gentaur Rabbit Antibodies
  • Gentaur Diagnostics
  • ICL Antibodies
  • ICL ELISA
  • ICL Isotype Control
  • ICL Loading Control
  • ICL Protein Standard
  • Shop By Brand

  • Gentaur
  • Immunology Consultatnt Laboratory
  • Maxanim
  • View all Brands
  • Content Pages

  • Guides
    • Guides
    • FAQs
    • Indicaid Antigen 25 tests box
    • antibodies covid 19
    • Elisa Kits
    • cia kids camp
    • Advances in mRNA Vaccines
    • An Investigation of Intraspecific Variations
    • antibodies covid
    • Man caught wearing fake arm in bid to fool staff giving Covid vaccine
    • Antibodies fade
    • Coronavirus where you live in the UK
    • antibodies for coronavirus immunity
    • antibodies for coronavirus
    • Biology Cells
    • Antibodies fading
    • clima kissimmee florida
    • Assay Kits
    • antibodies in blood
    • Biology Cell
    • cdna def
    • Cdnap
    • cdna.tv
    • cdna nyc - PRS BioSciences
    • Clia Kits
    • clia citation - PRS BioSciences
    • cdna lab - PRS BioSciences Confocal GFP Probes
    • Culture Cells
    • cia kids classes
    • DNA
    • Correlative Microscopy Insight on Electrodeposited Ultrathin Graphite Oxide Films
    • Contacting Photonic Research Systems
    • clima kissimmee – PRS BioSciences
    • Cryptosporidium spp. and Giardia spp. (oo)cysts as target-organisms in sanitation and environmental monitoring: A review in microscopy-based viability assays
    • Devices
    • dna template strand read in what direction
    • Gels
    • equipmentshare ceo - PRS BioSciences
    • Enzymes
    • Frequently Asked Question
    • Exosomes
    • Hypothesis-driven quantitative fluorescence microscopy – the importance of reverse-thinking in experimental design
    • gelsemium homeopathic - PRS BioSciences
    • Imagex TGi
    • imagex-nanoccd
    • imagex-tgi
    • isotopes of argon - PRS BioSciences
    • isotopes of hydrogen
    • isotopes of oxygen
    • isotopes of lead
    • isotopes of oxygen-16
    • isotopes of rhenium
    • isotopes of sulfur
    • isotopes of water
    • isotopes of xenon
    • isotopes of ytterbium
    • isotopes that decay slowly are used to date
    • isotopes website
    • Isotypes
    • isotypes bio meaning
    • isotypes of immunoglobulin
    • Light Sources
    • Medium & Serums
    • News
    • NATtrol
    • Non-classical crystallisation pathway directly observed for a pharmaceutical crystal via liquid phase electron microscopy
    • Panel
    • Nonlinear Optical Microscopy: From Fundamentals to Applications in Live Bioimaging
    • Particles
    • PCR
    • Pcr Kits
    • Price List
    • Products
    • Pulse300 Flashlamp
    • Pulsed Lightsources for Time-Gated Imaging
    • References
    • ria kista - PRS BioSciences Confocal GFP Probes
    • Renal amyloidosis with emphasis on the diagnostic role of electron microscopy
    • rna definition - PRS BioSciences Confocal GFP Probes
    • rna fish - PRS BioSciences Confocal GFP Probes
    • rna polymerase
    • rna primer
    • rna replication - PRS BioSciences
    • rna sequencing
    • rna structure - PRS BioSciences Confocal GFP Probes
    • rna splicing
    • rna velocity
    • rna vaccine wiki
    • Tag: antibodies test for coronavirus
    • Tag: antibodies covid
    • Tag: biology cells revision notes gcse
    • Tag: dna template strand read in what direction
    • Tag: dna template strand to amino acid translation
    • Tag: equipment shunned by fly fishers crossword
    • Tag: isotopes of copper
    • Tag: isotopes of nitrogen
    • Tag: isotypes of antibodies and their function
    • Tag: isotypes of antibodies
    • Tag: isotopes of uranium
    • Tag: rna meaning
    • Tag: test kits for meth - PRS BioSciences Confocal GFP Probes
    • test kits for coronavirus
    • Turnkey Imaging Systems
    • Useful Links
    • Viral detection of the Corona type
    • Validation of a DKK1 RNAscope
    • rna sequence
    • Tag: rna reset
    • cDNA
    • DNA Testing
    • culture cells meaning - PRS BioSciences
    • antibodies decline
    • elisa kits thermo fisher
    • antibodies definition - PRS BioSciences Confocal GFP Probes
  • Welcome to PRS!
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Rapid Antigen Test AG Nasopharyngeal Capilia™ TB Neo - 10 Tests
    • Ria kits run 2019
  • User Navigation

  • LoginorSign Up
×
  • Guides
    • Guides
    • FAQs
    • Indicaid Antigen 25 tests box
    • antibodies covid 19
    • Elisa Kits
    • cia kids camp
    • Advances in mRNA Vaccines
    • An Investigation of Intraspecific Variations
    • antibodies covid
    • Man caught wearing fake arm in bid to fool staff giving Covid vaccine
    • Antibodies fade
    • Coronavirus where you live in the UK
    • antibodies for coronavirus immunity
    • antibodies for coronavirus
    • Biology Cells
    • Antibodies fading
    • clima kissimmee florida
    • Assay Kits
    • antibodies in blood
    • Biology Cell
    • cdna def
    • Cdnap
    • cdna.tv
    • cdna nyc - PRS BioSciences
    • Clia Kits
    • clia citation - PRS BioSciences
    • cdna lab - PRS BioSciences Confocal GFP Probes
    • Culture Cells
    • cia kids classes
    • DNA
    • Correlative Microscopy Insight on Electrodeposited Ultrathin Graphite Oxide Films
    • Contacting Photonic Research Systems
    • clima kissimmee – PRS BioSciences
    • Cryptosporidium spp. and Giardia spp. (oo)cysts as target-organisms in sanitation and environmental monitoring: A review in microscopy-based viability assays
    • Devices
    • dna template strand read in what direction
    • Gels
    • equipmentshare ceo - PRS BioSciences
    • Enzymes
    • Frequently Asked Question
    • Exosomes
    • Hypothesis-driven quantitative fluorescence microscopy – the importance of reverse-thinking in experimental design
    • gelsemium homeopathic - PRS BioSciences
    • Imagex TGi
    • imagex-nanoccd
    • imagex-tgi
    • isotopes of argon - PRS BioSciences
    • isotopes of hydrogen
    • isotopes of oxygen
    • isotopes of lead
    • isotopes of oxygen-16
    • isotopes of rhenium
    • isotopes of sulfur
    • isotopes of water
    • isotopes of xenon
    • isotopes of ytterbium
    • isotopes that decay slowly are used to date
    • isotopes website
    • Isotypes
    • isotypes bio meaning
    • isotypes of immunoglobulin
    • Light Sources
    • Medium & Serums
    • News
    • NATtrol
    • Non-classical crystallisation pathway directly observed for a pharmaceutical crystal via liquid phase electron microscopy
    • Panel
    • Nonlinear Optical Microscopy: From Fundamentals to Applications in Live Bioimaging
    • Particles
    • PCR
    • Pcr Kits
    • Price List
    • Products
    • Pulse300 Flashlamp
    • Pulsed Lightsources for Time-Gated Imaging
    • References
    • ria kista - PRS BioSciences Confocal GFP Probes
    • Renal amyloidosis with emphasis on the diagnostic role of electron microscopy
    • rna definition - PRS BioSciences Confocal GFP Probes
    • rna fish - PRS BioSciences Confocal GFP Probes
    • rna polymerase
    • rna primer
    • rna replication - PRS BioSciences
    • rna sequencing
    • rna structure - PRS BioSciences Confocal GFP Probes
    • rna splicing
    • rna velocity
    • rna vaccine wiki
    • Tag: antibodies test for coronavirus
    • Tag: antibodies covid
    • Tag: biology cells revision notes gcse
    • Tag: dna template strand read in what direction
    • Tag: dna template strand to amino acid translation
    • Tag: equipment shunned by fly fishers crossword
    • Tag: isotopes of copper
    • Tag: isotopes of nitrogen
    • Tag: isotypes of antibodies and their function
    • Tag: isotypes of antibodies
    • Tag: isotopes of uranium
    • Tag: rna meaning
    • Tag: test kits for meth - PRS BioSciences Confocal GFP Probes
    • test kits for coronavirus
    • Turnkey Imaging Systems
    • Useful Links
    • Viral detection of the Corona type
    • Validation of a DKK1 RNAscope
    • rna sequence
    • Tag: rna reset
    • cDNA
    • DNA Testing
    • culture cells meaning - PRS BioSciences
    • antibodies decline
    • elisa kits thermo fisher
    • antibodies definition - PRS BioSciences Confocal GFP Probes
  • Welcome to PRS!
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Rapid Antigen Test AG Nasopharyngeal Capilia™ TB Neo - 10 Tests
    • Ria kits run 2019
  • Home
  • Gentaur Antibodies
  • Gentaur Polyclonal Antibodies
  • Anti-H2AFB3 pAb | Gentaur
  • Anti-H2AFB3 pAb
  • Anti-H2AFB3 pAb

    Anti-H2AFB3 pAb | Gentaur

    Gentaur

    MSRP:
    Now: €340.00
    (You save )
    (No reviews yet) Write a Review
    SKU:
    513-DPAB-DC3438-GEN
    Availability:
    IN STOCK
    Size:
    100 µg

    Adding to cart… category.add_cart_announcement
    Add to Wish List
    • Create New Wish List
    • Facebook
    • Email
    • Print
    • Twitter
    • Pinterest
    • Overview
    • Reviews

    Product Description

    Anti-H2AFB3 pAb

    Host Species Mouse

    Species Reactivity Human

    Immunogen H2AFB3 (NP_542451, 19 a.a. ~ 115 a.a) partial recombinant protein with GST tag. The sequence is TCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

    Conjugate Unconjugated

    Target


    Alternative Names H2AFB3; H2A histone family, member B3; H2AFB; H2ABBD; histone H2A-Bbd type 2/3; H2A.Bbd

    Product Videos

    Custom Field

    Size 100 µg

    Product Reviews

    Write a Review

    Write a Review

    ×
    Anti-H2AFB3 pAb
    Gentaur
    Anti-H2AFB3 pAb | Gentaur

    ×

    Recommended

    • Anti-Ager pAb Anti-Ager pAb
      Quick view Details

      Gentaur

      |

      sku: 513-CPBT-66799GH-GEN

      Anti-Ager pAb | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Anti GFP Rabbit pAb Anti GFP Rabbit pAb
      Quick view Details

      Gentaur

      |

      sku: 544-MBS691276-GEN

      Anti GFP Rabbit pAb | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Rabbit Anti-LukA pAb Rabbit Anti-LukA pAb
      Quick view Details

      Gentaur

      |

      sku: 494-0316-001-GEN

      Rabbit Anti-LukA pAb | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Anti-PMN Rabbit pAb Anti-PMN Rabbit pAb
      Quick view Details

      Gentaur

      |

      sku: 118-20R-PR103-GEN

      Anti-PMN Rabbit pAb | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Rabbit Anti-LukB pAb Rabbit Anti-LukB pAb
      Quick view Details

      Gentaur

      |

      sku: 494-0317-001-GEN

      Rabbit Anti-LukB pAb | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    ×

    Join Our Mailing List for special offers!


    Contact Us

    Unicorn House +2, Station Cl
    Potters Bar EN6 1TL
    United Kingdom

    Account

    • Wishlist
    • Login or Sign Up
    • Shipping & Returns

    Navigate

    • Guides
    • Welcome to PRS!
    • Shipping & Returns
    • Contact Us
    • Blog

    Recent Blog Posts

    • Light Microscope
    • Plant Preservative Mixture (PPM) Protocols
    • direct pcr lysis buffer
    • pGEX Vectors
    • RNA STAT-60 Rapid RNA Isolation Reagent
    • © PRS BioSciences | IHC Microscopy |
    • Sitemap |
    • Premium BigCommerce Theme by Lone Star Templates