Toggle menu
+44 20 3393 8531
  • LoginorSign Up
  • 0
PRS BioSciences | IHC Microscopy
×
×

    Shop By Category

  • Gentaur Antibodies
    • Gentaur Antibodies
    • Gentaur Goat Antibodies
    • Gentaur Human Antibodies
    • Gentaur Monoclonal Antibodies
    • Gentaur Mouse Antibodies
    • Gentaur Polyclonal Antibodies
    • Gentaur Rabbit Antibodies
  • Gentaur Diagnostics
  • ICL Antibodies
  • ICL ELISA
  • ICL Isotype Control
  • ICL Loading Control
  • ICL Protein Standard
  • Shop By Brand

  • Gentaur
  • Immunology Consultatnt Laboratory
  • Maxanim
  • View all Brands
  • Content Pages

  • Guides
    • Guides
    • FAQs
    • Indicaid Antigen 25 tests box
    • antibodies covid 19
    • Elisa Kits
    • cia kids camp
    • Advances in mRNA Vaccines
    • An Investigation of Intraspecific Variations
    • antibodies covid
    • Man caught wearing fake arm in bid to fool staff giving Covid vaccine
    • Antibodies fade
    • Coronavirus where you live in the UK
    • antibodies for coronavirus immunity
    • antibodies for coronavirus
    • Biology Cells
    • Antibodies fading
    • clima kissimmee florida
    • Assay Kits
    • antibodies in blood
    • Biology Cell
    • cdna def
    • Cdnap
    • cdna.tv
    • cdna nyc - PRS BioSciences
    • Clia Kits
    • clia citation - PRS BioSciences
    • cdna lab - PRS BioSciences Confocal GFP Probes
    • Culture Cells
    • cia kids classes
    • DNA
    • Correlative Microscopy Insight on Electrodeposited Ultrathin Graphite Oxide Films
    • Contacting Photonic Research Systems
    • clima kissimmee – PRS BioSciences
    • Cryptosporidium spp. and Giardia spp. (oo)cysts as target-organisms in sanitation and environmental monitoring: A review in microscopy-based viability assays
    • Devices
    • dna template strand read in what direction
    • Gels
    • equipmentshare ceo - PRS BioSciences
    • Enzymes
    • Frequently Asked Question
    • Exosomes
    • Hypothesis-driven quantitative fluorescence microscopy – the importance of reverse-thinking in experimental design
    • gelsemium homeopathic - PRS BioSciences
    • Imagex TGi
    • imagex-nanoccd
    • imagex-tgi
    • isotopes of argon - PRS BioSciences
    • isotopes of hydrogen
    • isotopes of oxygen
    • isotopes of lead
    • isotopes of oxygen-16
    • isotopes of rhenium
    • isotopes of sulfur
    • isotopes of water
    • isotopes of xenon
    • isotopes of ytterbium
    • isotopes that decay slowly are used to date
    • isotopes website
    • Isotypes
    • isotypes bio meaning
    • isotypes of immunoglobulin
    • Light Sources
    • Medium & Serums
    • News
    • NATtrol
    • Non-classical crystallisation pathway directly observed for a pharmaceutical crystal via liquid phase electron microscopy
    • Panel
    • Nonlinear Optical Microscopy: From Fundamentals to Applications in Live Bioimaging
    • Particles
    • PCR
    • Pcr Kits
    • Price List
    • Products
    • Pulse300 Flashlamp
    • Pulsed Lightsources for Time-Gated Imaging
    • References
    • ria kista - PRS BioSciences Confocal GFP Probes
    • Renal amyloidosis with emphasis on the diagnostic role of electron microscopy
    • rna definition - PRS BioSciences Confocal GFP Probes
    • rna fish - PRS BioSciences Confocal GFP Probes
    • rna polymerase
    • rna primer
    • rna replication - PRS BioSciences
    • rna sequencing
    • rna structure - PRS BioSciences Confocal GFP Probes
    • rna splicing
    • rna velocity
    • rna vaccine wiki
    • Tag: antibodies test for coronavirus
    • Tag: antibodies covid
    • Tag: biology cells revision notes gcse
    • Tag: dna template strand read in what direction
    • Tag: dna template strand to amino acid translation
    • Tag: equipment shunned by fly fishers crossword
    • Tag: isotopes of copper
    • Tag: isotopes of nitrogen
    • Tag: isotypes of antibodies and their function
    • Tag: isotypes of antibodies
    • Tag: isotopes of uranium
    • Tag: rna meaning
    • Tag: test kits for meth - PRS BioSciences Confocal GFP Probes
    • test kits for coronavirus
    • Turnkey Imaging Systems
    • Useful Links
    • Viral detection of the Corona type
    • Validation of a DKK1 RNAscope
    • rna sequence
    • Tag: rna reset
    • cDNA
    • DNA Testing
    • culture cells meaning - PRS BioSciences
    • antibodies decline
    • elisa kits thermo fisher
    • antibodies definition - PRS BioSciences Confocal GFP Probes
  • Welcome to PRS!
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Rapid Antigen Test AG Nasopharyngeal Capilia™ TB Neo - 10 Tests
    • Ria kits run 2019
  • User Navigation

  • LoginorSign Up
×
  • Guides
    • Guides
    • FAQs
    • Indicaid Antigen 25 tests box
    • antibodies covid 19
    • Elisa Kits
    • cia kids camp
    • Advances in mRNA Vaccines
    • An Investigation of Intraspecific Variations
    • antibodies covid
    • Man caught wearing fake arm in bid to fool staff giving Covid vaccine
    • Antibodies fade
    • Coronavirus where you live in the UK
    • antibodies for coronavirus immunity
    • antibodies for coronavirus
    • Biology Cells
    • Antibodies fading
    • clima kissimmee florida
    • Assay Kits
    • antibodies in blood
    • Biology Cell
    • cdna def
    • Cdnap
    • cdna.tv
    • cdna nyc - PRS BioSciences
    • Clia Kits
    • clia citation - PRS BioSciences
    • cdna lab - PRS BioSciences Confocal GFP Probes
    • Culture Cells
    • cia kids classes
    • DNA
    • Correlative Microscopy Insight on Electrodeposited Ultrathin Graphite Oxide Films
    • Contacting Photonic Research Systems
    • clima kissimmee – PRS BioSciences
    • Cryptosporidium spp. and Giardia spp. (oo)cysts as target-organisms in sanitation and environmental monitoring: A review in microscopy-based viability assays
    • Devices
    • dna template strand read in what direction
    • Gels
    • equipmentshare ceo - PRS BioSciences
    • Enzymes
    • Frequently Asked Question
    • Exosomes
    • Hypothesis-driven quantitative fluorescence microscopy – the importance of reverse-thinking in experimental design
    • gelsemium homeopathic - PRS BioSciences
    • Imagex TGi
    • imagex-nanoccd
    • imagex-tgi
    • isotopes of argon - PRS BioSciences
    • isotopes of hydrogen
    • isotopes of oxygen
    • isotopes of lead
    • isotopes of oxygen-16
    • isotopes of rhenium
    • isotopes of sulfur
    • isotopes of water
    • isotopes of xenon
    • isotopes of ytterbium
    • isotopes that decay slowly are used to date
    • isotopes website
    • Isotypes
    • isotypes bio meaning
    • isotypes of immunoglobulin
    • Light Sources
    • Medium & Serums
    • News
    • NATtrol
    • Non-classical crystallisation pathway directly observed for a pharmaceutical crystal via liquid phase electron microscopy
    • Panel
    • Nonlinear Optical Microscopy: From Fundamentals to Applications in Live Bioimaging
    • Particles
    • PCR
    • Pcr Kits
    • Price List
    • Products
    • Pulse300 Flashlamp
    • Pulsed Lightsources for Time-Gated Imaging
    • References
    • ria kista - PRS BioSciences Confocal GFP Probes
    • Renal amyloidosis with emphasis on the diagnostic role of electron microscopy
    • rna definition - PRS BioSciences Confocal GFP Probes
    • rna fish - PRS BioSciences Confocal GFP Probes
    • rna polymerase
    • rna primer
    • rna replication - PRS BioSciences
    • rna sequencing
    • rna structure - PRS BioSciences Confocal GFP Probes
    • rna splicing
    • rna velocity
    • rna vaccine wiki
    • Tag: antibodies test for coronavirus
    • Tag: antibodies covid
    • Tag: biology cells revision notes gcse
    • Tag: dna template strand read in what direction
    • Tag: dna template strand to amino acid translation
    • Tag: equipment shunned by fly fishers crossword
    • Tag: isotopes of copper
    • Tag: isotopes of nitrogen
    • Tag: isotypes of antibodies and their function
    • Tag: isotypes of antibodies
    • Tag: isotopes of uranium
    • Tag: rna meaning
    • Tag: test kits for meth - PRS BioSciences Confocal GFP Probes
    • test kits for coronavirus
    • Turnkey Imaging Systems
    • Useful Links
    • Viral detection of the Corona type
    • Validation of a DKK1 RNAscope
    • rna sequence
    • Tag: rna reset
    • cDNA
    • DNA Testing
    • culture cells meaning - PRS BioSciences
    • antibodies decline
    • elisa kits thermo fisher
    • antibodies definition - PRS BioSciences Confocal GFP Probes
  • Welcome to PRS!
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Rapid Antigen Test AG Nasopharyngeal Capilia™ TB Neo - 10 Tests
    • Ria kits run 2019
  • Home
  • Gentaur Antibodies
  • C1orf151 Antibody, middle region | Gentaur
  • C1orf151 Antibody, middle region
  • C1orf151 Antibody, middle region

    C1orf151 Antibody, middle region | Gentaur

    Gentaur

    MSRP:
    Now: €340.00
    (You save )
    (No reviews yet) Write a Review
    SKU:
    247-ARP44801_P050-GEN
    Availability:
    IN STOCK
    Size:
    100 µg

    Adding to cart… category.add_cart_announcement
    Add to Wish List
    • Create New Wish List
    • Facebook
    • Email
    • Print
    • Twitter
    • Pinterest
    • Overview
    • Reviews

    Product Description

    C1orf151 Antibody, middle region

    Product Info Tested Species Reactivity Human

    Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit

    Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

    Clonality Polyclonal

    Host Rabbit

    Application WB

    Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

    Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf151

    Purification Affinity Purified

    Predicted Homology Based on

    Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

    Complete computational species homology data Anti-C1orf151 (ARP44801_P050)

    Peptide Sequence Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

    Concentration 0.5 mg/ml

    Product Videos

    Custom Field

    Size 100 µg

    Product Reviews

    Write a Review

    Write a Review

    ×
    C1orf151 Antibody, middle region
    Gentaur
    C1orf151 Antibody, middle region | Gentaur

    ×

    Recommended

    • MCUB Antibody - middle region MCUB Antibody - middle region
      Quick view Details

      Gentaur

      |

      sku: 247-ARP94335_P050-GEN

      MCUB Antibody - middle region | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • AMH Antibody - middle region AMH Antibody - middle region
      Quick view Details

      Gentaur

      |

      sku: 247-ARP54312_P050-GEN

      AMH Antibody - middle region | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • TSG101 Antibody - C-terminal region TSG101 Antibody - C-terminal region
      Quick view Details

      Gentaur

      |

      sku: 247-ARP38773_T100-GEN

      TSG101 Antibody - C-terminal region | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • CD81 Antibody - C-terminal region CD81 Antibody - C-terminal region
      Quick view Details

      Gentaur

      |

      sku: 247-ARP63231_P050-GEN

      CD81 Antibody - C-terminal region | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Prohibitin Antibody Prohibitin Antibody
      Quick view Details

      Gentaur

      |

      sku: 26-3805-100-GEN

      Prohibitin Antibody | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    ×

    Join Our Mailing List for special offers!


    Contact Us

    Unicorn House +2, Station Cl
    Potters Bar EN6 1TL
    United Kingdom

    Account

    • Wishlist
    • Login or Sign Up
    • Shipping & Returns

    Navigate

    • Guides
    • Welcome to PRS!
    • Shipping & Returns
    • Contact Us
    • Blog

    Recent Blog Posts

    • Gel Electrophoresis System: Apparatus, Parts, Types, and Applications
    • Light Microscope
    • Plant Preservative Mixture (PPM) Protocols
    • direct pcr lysis buffer
    • pGEX Vectors
    • © PRS BioSciences | IHC Microscopy |
    • Sitemap |
    • Premium BigCommerce Theme by Lone Star Templates