Toggle menu
+44 20 3393 8531
  • LoginorSign Up
  • 0
PRS BioSciences | IHC Microscopy
×
×

    Shop By Category

  • Gentaur Antibodies
    • Gentaur Antibodies
    • Gentaur Goat Antibodies
    • Gentaur Human Antibodies
    • Gentaur Monoclonal Antibodies
    • Gentaur Mouse Antibodies
    • Gentaur Polyclonal Antibodies
    • Gentaur Rabbit Antibodies
  • Gentaur Diagnostics
  • ICL Antibodies
  • ICL ELISA
  • ICL Isotype Control
  • ICL Loading Control
  • ICL Protein Standard
  • Shop By Brand

  • Gentaur
  • Immunology Consultatnt Laboratory
  • Maxanim
  • View all Brands
  • Content Pages

  • Guides
    • Guides
    • FAQs
    • Indicaid Antigen 25 tests box
    • antibodies covid 19
    • Elisa Kits
    • cia kids camp
    • Advances in mRNA Vaccines
    • An Investigation of Intraspecific Variations
    • antibodies covid
    • Man caught wearing fake arm in bid to fool staff giving Covid vaccine
    • Antibodies fade
    • Coronavirus where you live in the UK
    • antibodies for coronavirus immunity
    • antibodies for coronavirus
    • Biology Cells
    • Antibodies fading
    • clima kissimmee florida
    • Assay Kits
    • antibodies in blood
    • Biology Cell
    • cdna def
    • Cdnap
    • cdna.tv
    • cdna nyc - PRS BioSciences
    • Clia Kits
    • clia citation - PRS BioSciences
    • cdna lab - PRS BioSciences Confocal GFP Probes
    • Culture Cells
    • cia kids classes
    • DNA
    • Correlative Microscopy Insight on Electrodeposited Ultrathin Graphite Oxide Films
    • Contacting Photonic Research Systems
    • clima kissimmee – PRS BioSciences
    • Cryptosporidium spp. and Giardia spp. (oo)cysts as target-organisms in sanitation and environmental monitoring: A review in microscopy-based viability assays
    • Devices
    • dna template strand read in what direction
    • Gels
    • equipmentshare ceo - PRS BioSciences
    • Enzymes
    • Frequently Asked Question
    • Exosomes
    • Hypothesis-driven quantitative fluorescence microscopy – the importance of reverse-thinking in experimental design
    • gelsemium homeopathic - PRS BioSciences
    • Imagex TGi
    • imagex-nanoccd
    • imagex-tgi
    • isotopes of argon - PRS BioSciences
    • isotopes of hydrogen
    • isotopes of oxygen
    • isotopes of lead
    • isotopes of oxygen-16
    • isotopes of rhenium
    • isotopes of sulfur
    • isotopes of water
    • isotopes of xenon
    • isotopes of ytterbium
    • isotopes that decay slowly are used to date
    • isotopes website
    • Isotypes
    • isotypes bio meaning
    • isotypes of immunoglobulin
    • Light Sources
    • Medium & Serums
    • News
    • NATtrol
    • Non-classical crystallisation pathway directly observed for a pharmaceutical crystal via liquid phase electron microscopy
    • Panel
    • Nonlinear Optical Microscopy: From Fundamentals to Applications in Live Bioimaging
    • Particles
    • PCR
    • Pcr Kits
    • Price List
    • Products
    • Pulse300 Flashlamp
    • Pulsed Lightsources for Time-Gated Imaging
    • References
    • ria kista - PRS BioSciences Confocal GFP Probes
    • Renal amyloidosis with emphasis on the diagnostic role of electron microscopy
    • rna definition - PRS BioSciences Confocal GFP Probes
    • rna fish - PRS BioSciences Confocal GFP Probes
    • rna polymerase
    • rna primer
    • rna replication - PRS BioSciences
    • rna sequencing
    • rna structure - PRS BioSciences Confocal GFP Probes
    • rna splicing
    • rna velocity
    • rna vaccine wiki
    • Tag: antibodies test for coronavirus
    • Tag: antibodies covid
    • Tag: biology cells revision notes gcse
    • Tag: dna template strand read in what direction
    • Tag: dna template strand to amino acid translation
    • Tag: equipment shunned by fly fishers crossword
    • Tag: isotopes of copper
    • Tag: isotopes of nitrogen
    • Tag: isotypes of antibodies and their function
    • Tag: isotypes of antibodies
    • Tag: isotopes of uranium
    • Tag: rna meaning
    • Tag: test kits for meth - PRS BioSciences Confocal GFP Probes
    • test kits for coronavirus
    • Turnkey Imaging Systems
    • Useful Links
    • Viral detection of the Corona type
    • Validation of a DKK1 RNAscope
    • rna sequence
    • Tag: rna reset
    • cDNA
    • DNA Testing
    • culture cells meaning - PRS BioSciences
    • antibodies decline
    • elisa kits thermo fisher
    • antibodies definition - PRS BioSciences Confocal GFP Probes
  • Welcome to PRS!
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Rapid Antigen Test AG Nasopharyngeal Capilia™ TB Neo - 10 Tests
    • Ria kits run 2019
  • User Navigation

  • LoginorSign Up
×
  • Guides
    • Guides
    • FAQs
    • Indicaid Antigen 25 tests box
    • antibodies covid 19
    • Elisa Kits
    • cia kids camp
    • Advances in mRNA Vaccines
    • An Investigation of Intraspecific Variations
    • antibodies covid
    • Man caught wearing fake arm in bid to fool staff giving Covid vaccine
    • Antibodies fade
    • Coronavirus where you live in the UK
    • antibodies for coronavirus immunity
    • antibodies for coronavirus
    • Biology Cells
    • Antibodies fading
    • clima kissimmee florida
    • Assay Kits
    • antibodies in blood
    • Biology Cell
    • cdna def
    • Cdnap
    • cdna.tv
    • cdna nyc - PRS BioSciences
    • Clia Kits
    • clia citation - PRS BioSciences
    • cdna lab - PRS BioSciences Confocal GFP Probes
    • Culture Cells
    • cia kids classes
    • DNA
    • Correlative Microscopy Insight on Electrodeposited Ultrathin Graphite Oxide Films
    • Contacting Photonic Research Systems
    • clima kissimmee – PRS BioSciences
    • Cryptosporidium spp. and Giardia spp. (oo)cysts as target-organisms in sanitation and environmental monitoring: A review in microscopy-based viability assays
    • Devices
    • dna template strand read in what direction
    • Gels
    • equipmentshare ceo - PRS BioSciences
    • Enzymes
    • Frequently Asked Question
    • Exosomes
    • Hypothesis-driven quantitative fluorescence microscopy – the importance of reverse-thinking in experimental design
    • gelsemium homeopathic - PRS BioSciences
    • Imagex TGi
    • imagex-nanoccd
    • imagex-tgi
    • isotopes of argon - PRS BioSciences
    • isotopes of hydrogen
    • isotopes of oxygen
    • isotopes of lead
    • isotopes of oxygen-16
    • isotopes of rhenium
    • isotopes of sulfur
    • isotopes of water
    • isotopes of xenon
    • isotopes of ytterbium
    • isotopes that decay slowly are used to date
    • isotopes website
    • Isotypes
    • isotypes bio meaning
    • isotypes of immunoglobulin
    • Light Sources
    • Medium & Serums
    • News
    • NATtrol
    • Non-classical crystallisation pathway directly observed for a pharmaceutical crystal via liquid phase electron microscopy
    • Panel
    • Nonlinear Optical Microscopy: From Fundamentals to Applications in Live Bioimaging
    • Particles
    • PCR
    • Pcr Kits
    • Price List
    • Products
    • Pulse300 Flashlamp
    • Pulsed Lightsources for Time-Gated Imaging
    • References
    • ria kista - PRS BioSciences Confocal GFP Probes
    • Renal amyloidosis with emphasis on the diagnostic role of electron microscopy
    • rna definition - PRS BioSciences Confocal GFP Probes
    • rna fish - PRS BioSciences Confocal GFP Probes
    • rna polymerase
    • rna primer
    • rna replication - PRS BioSciences
    • rna sequencing
    • rna structure - PRS BioSciences Confocal GFP Probes
    • rna splicing
    • rna velocity
    • rna vaccine wiki
    • Tag: antibodies test for coronavirus
    • Tag: antibodies covid
    • Tag: biology cells revision notes gcse
    • Tag: dna template strand read in what direction
    • Tag: dna template strand to amino acid translation
    • Tag: equipment shunned by fly fishers crossword
    • Tag: isotopes of copper
    • Tag: isotopes of nitrogen
    • Tag: isotypes of antibodies and their function
    • Tag: isotypes of antibodies
    • Tag: isotopes of uranium
    • Tag: rna meaning
    • Tag: test kits for meth - PRS BioSciences Confocal GFP Probes
    • test kits for coronavirus
    • Turnkey Imaging Systems
    • Useful Links
    • Viral detection of the Corona type
    • Validation of a DKK1 RNAscope
    • rna sequence
    • Tag: rna reset
    • cDNA
    • DNA Testing
    • culture cells meaning - PRS BioSciences
    • antibodies decline
    • elisa kits thermo fisher
    • antibodies definition - PRS BioSciences Confocal GFP Probes
  • Welcome to PRS!
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Rapid Antigen Test AG Nasopharyngeal Capilia™ TB Neo - 10 Tests
    • Ria kits run 2019
  • Home
  • Gentaur Antibodies
  • Gentaur Mouse Antibodies
  • Mouse Anti-Human HSD3B7 aa 101-209 | Gentaur
  • Mouse Anti-Human HSD3B7 aa 101-209
  • Mouse Anti-Human HSD3B7 aa 101-209

    Mouse Anti-Human HSD3B7 aa 101-209 | Gentaur

    Gentaur

    MSRP:
    Now: €340.00
    (You save )
    (No reviews yet) Write a Review
    SKU:
    513-DPAB-DC3313-GEN
    Availability:
    IN STOCK
    Size:
    100 µg

    Adding to cart… category.add_cart_announcement
    Add to Wish List
    • Create New Wish List
    • Facebook
    • Email
    • Print
    • Twitter
    • Pinterest
    • Overview
    • Reviews

    Product Description

    Mouse Anti-Human HSD3B7 aa 101-209

    Host Species Mouse
     
    Species Reactivity Human
     
    Immunogen HSD3B7 (NP_079469, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. The sequence is IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG
     
    Conjugate Unconjugated
     
    Alternative Names HSD3B7; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7; CBAS1; PFIC4; SDR11E3; 3 beta-hydroxysteroid dehydrogenase type 7
     
    Entrez Gene ID 80270
     
    UniProt ID Q9H2F3
     

    We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody.

    Product Videos

    Custom Field

    Size 100 µg

    Product Reviews

    Write a Review

    Write a Review

    ×
    Mouse Anti-Human HSD3B7 aa 101-209
    Gentaur
    Mouse Anti-Human HSD3B7 aa 101-209 | Gentaur

    ×

    Recommended

    • Monoclonal Mouse Anti-Human Monoclonal Mouse Anti-Human
      Quick view Details

      Gentaur

      |

      sku: 237-M356901-GEN

      Monoclonal Mouse Anti-Human | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Mouse Anti-Human a-Synuclein Mouse Anti-Human a-Synuclein
      Quick view Details

      Gentaur

      |

      sku: 513-CABT-B1398-GEN

      Mouse Anti-Human a-Synuclein | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Mouse Anti-Human Selectin Mouse Anti-Human Selectin
      Quick view Details

      Gentaur

      |

      sku: 544-MBS2056489-GEN

      Mouse Anti-Human Selectin | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Mouse Anti-Human AKR1C1 Mouse Anti-Human AKR1C1
      Quick view Details

      Gentaur

      |

      sku: 513-DCABH-10473-GEN

      Mouse Anti-Human AKR1C1 | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    • Mouse Anti Human MCAM Mouse Anti Human MCAM
      Quick view Details

      Gentaur

      |

      sku: 544-MBS4381078-GEN

      Mouse Anti Human MCAM | Gentaur

      MSRP:
      Now: €340.00
      Add to Cart
    ×

    Join Our Mailing List for special offers!


    Contact Us

    Unicorn House +2, Station Cl
    Potters Bar EN6 1TL
    United Kingdom

    Account

    • Wishlist
    • Login or Sign Up
    • Shipping & Returns

    Navigate

    • Guides
    • Welcome to PRS!
    • Shipping & Returns
    • Contact Us
    • Blog

    Recent Blog Posts

    • Combur Test: A Reliable Solution for Rapid and Accurate Urinalysis
    • Exploring the Power of ELISA: Detecting Serum Proteins for Medical Insights
    • © PRS BioSciences | IHC Microscopy |
    • Sitemap |
    • Premium BigCommerce Theme by Lone Star Templates